Meine Sitzung geöffnet lassen?
Endet in 
Ihre Sitzung ist abgelaufen
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-SOX10 Mouse Monoclonal Antibody [clone: 1E6]

Lieferant: US Biological
Recommended dilution: Immunochemistry: 1. 5 μg/ml

Type: Primary
Antigen: SOX10 (SRY (sex determining region Y)-box 10)
Clonality: monoclonal
Clone: 1000000
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 µg 100 µG USBI133713
Generate Barcodes Barcode Label Format: 
PDF Katalogseiten erstellen

TECHNISCHE DATEN

Antigen symbol SOX10
Antigen name SRY (sex determining region Y)-box 10
Reaktivität Human
Konjugation Unconjugated
Klonalität Monoclonal
Antikörper Typ Primary
Clone 1E6
Wirt Mouse
Isotyp IgG2a kappa
Western blot Yes
ELISA Yes
Amino acid number 336 to 434
Purification purified by Protein A chromatography
Sequence KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR*
Form liquid
Storage buffer PBS, pH 7,2.
Lagertemperatur Cool
Transporttemperatur Ice
Enter Details

Wählen Sie den Artikel dessen Zertifikat Sie gesucht haben

Chargennummer ist ein Pflichtfeld. Falls Sie diese nicht zur Verfügung haben, tragen Sie "x" für VWR Chemikalien ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Oder
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge
 

Neues Design und unsere Verpflichtung unseren Kunden gegenüber

Verlassen Sie sich auf bekannte Funktionen und Ansprechpartner, kombiniert mit Innovation durch Avantor®. Unser neuer Markenauftritt symbolisiert Beweglichkeit und unsere Fähigkeit uns an die Anforderungen unserer Kunden anzupassen.

Learn More Start Shopping