Meine Sitzung geöffnet lassen?
Endet in 
Ihre Sitzung ist abgelaufen
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-SPG21 Mouse Monoclonal Antibody [clone: 2B11]

Lieferant: US Biological
Type: Primary
Antigen: SPG21 (spastic paraplegia 21 (autosomal recessive, Mast syndrome))
Clonality: monoclonal
Clone: 2B11
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 µg 100 µG USBI133761
Generate Barcodes Barcode Label Format: 
PDF Katalogseiten erstellen

TECHNISCHE DATEN

Antigen symbol SPG21
Antigen name spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Reaktivität Human
Konjugation Unconjugated
Klonalität Monoclonal
Antikörper Typ Primary
Clone 2B11
Wirt Mouse
Isotype IgG2a kappa
ELISA Yes
Amino acid number 211 to 307
Purification purified by Protein A chromatography
Sequence PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE
Form liquid
Storage buffer PBS, pH 7,2.
Lagertemperatur Cool
Transporttemperatur Ice
Enter Details

Wählen Sie den Artikel dessen Zertifikat Sie gesucht haben

Chargennummer ist ein Pflichtfeld. Falls Sie diese nicht zur Verfügung haben, tragen Sie "x" für VWR Chemikalien ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Oder
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge
 

Neues Design und unsere Verpflichtung unseren Kunden gegenüber

Verlassen Sie sich auf bekannte Funktionen und Ansprechpartner, kombiniert mit Innovation durch Avantor®. Unser neuer Markenauftritt symbolisiert Beweglichkeit und unsere Fähigkeit uns an die Anforderungen unserer Kunden anzupassen.

Learn More Start Shopping