Meine Sitzung geöffnet lassen?
Endet in 
Ihre Sitzung ist abgelaufen
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-KIAA0226 Mouse Monoclonal Antibody

Lieferant: Abnova
Mouse monoclonal antibody raised against a full-length recombinant KIAA0226.

Type: Primary
Antigen: KIAA0226
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Melden Sie sich an um Ihre Preise und die Verfügbarkeit zu sehen
  Auf diesem Gerät angemeldet bleiben
 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
Up to 5 Clones 1 ABNOH00009711-M
Generate Barcodes Barcode Label Format: 
PDF Katalogseiten erstellen

TECHNISCHE DATEN

Antigen symbol KIAA0226
Antigen name KIAA0226
Reaktivität Human
Konjugation Unconjugated
Klonalität Monoclonal
Antikörper Typ Primary
Wirt Mouse
Western Blot Yes
ELISA Yes
Antigen synonyms RUBICON, SCAR15
Amino acid number 1 to 375
Gene ID 9711
Format Liquid
Cross Adsorption No
Immunogen KIAA0226 (AAH33615.1, 1 a.a. ~ 375 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSSSNLFSSSSSQKPDSAASSLGDQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAPGNEEHRLLVSKMTLN
Enter Details

Wählen Sie den Artikel dessen Zertifikat Sie gesucht haben

Chargennummer ist ein Pflichtfeld. Falls Sie diese nicht zur Verfügung haben, tragen Sie "x" für VWR Chemikalien ein.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Oder
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge